PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC003705.30
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family GATA
Protein Properties Length: 118aa    MW: 13336 Da    PI: 9.9595
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC003705.30genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA58.68.5e-193164134
          GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34
                  C++C +t++p+WR gp g+ktLCnaCG++y+  +
  EcC003705.30 31 CVHCAATESPMWRLGPMGPKTLCNACGIRYKTGR 64
                  *******************************887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004011.1E-152575IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.4792561IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.14E-152687No hitNo description
Gene3DG3DSA:3.30.50.102.5E-152963IPR013088Zinc finger, NHR/GATA-type
CDDcd002029.55E-133077No hitNo description
PfamPF003201.6E-163164IPR000679Zinc finger, GATA-type
PROSITE patternPS0034403156IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0055085Biological Processtransmembrane transport
GO:0016021Cellular Componentintegral component of membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
GO:0022857Molecular Functiontransmembrane transporter activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 118 aa     Download sequence    Send to blast
SSLQEKPQDP AKRRRKEEDQ SPQQPNQPRR CVHCAATESP MWRLGPMGPK TLCNACGIRY  60
KTGRLFPEYR PSASPTYVPS LHSHFHKKVI RIREATNGED TEVAANAQRP SQLGNIES
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010046437.18e-84PREDICTED: GATA transcription factor 12-like
SwissprotQ9SV306e-33GATA8_ARATH; GATA transcription factor 8
TrEMBLA0A067LHG21e-33A0A067LHG2_JATCU; Uncharacterized protein
STRINGPOPTR_0008s03880.17e-33(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54810.23e-34GATA family protein